Product Description

CAT# P001
Product Name REN
Synonymes HNFJ2, Renin
Description Renin is a highly specific endopeptidase, whose only known function is to generate angiotensin I from angiotensinogen in the plasma, initiating a cascade of reactions that produce an elevation of blood pressure and increased sodium retention by the kidney. Renin is secreted from juxtaglomerular kidney cells and activates the renin-angiotensin system by cleaving angiotensinogen, produced by the liver, to yield angiotensin I, which is further converted into angiotensin II by ACE, the angiotensin-converting enzyme primarily within the capillaries of the lungs.
Amino Acid Sequence LTLGNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVY
HKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFM
LAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENSQSLGGQIVLGG
SDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIE
KLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAI
HAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR
Tag His-tag
Molecular Weight (kDa) 38
Species Human
Sourcse HEK293 cell
Biological Activity Active, Cleavage of Leu-|-Xaa bond in angiotensinogen to generate angiotensin I
Physical Appearance White lyophilized (freeze-dried) powder.
Formulation Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.4.
Reconstitution We recommend to briefly centrifuge the vial prior to opening it and bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1%BSA. Stock solutions should be aliquoted and stored at ≤ -20 °C.
Purity > 95 % by SDS-PAGE and HPLC analyses.
Endotoxin Level Less than 1 EU/μg of protein by LAL method.
Storeage This lyophilized preparation is stable at 2-8 °C but we recommend to keep it at -20 °C for long term storage. Upon reconstitution, the preparation is stable for a week at 2-8 °C. For maximal stability, the reconstituted aliquots is recommended to store at -20 °C to -70 °C. Avoid repeated freeze/thaw cycles.

[table id=1 /]